PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G170500.1
Common NamePHAVU_002G170500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 448aa    MW: 49403.2 Da    PI: 6.5088
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G170500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13e-16136181147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Phvul.002G170500.1 136 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 181
                         899*****************************.***********996 PP

2Myb_DNA-binding55.51.3e-17188231146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         r ++++eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Phvul.002G170500.1 188 RRAFSEEEEERLMQAHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 231
                         678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17131182IPR017930Myb domain
SMARTSM007172.9E-14135184IPR001005SANT/Myb domain
PfamPF002499.4E-16136181IPR001005SANT/Myb domain
SuperFamilySSF466898.61E-28136229IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-25137189IPR009057Homeodomain-like
CDDcd001673.49E-13139180No hitNo description
PROSITE profilePS5129426.929183237IPR017930Myb domain
SMARTSM007171.8E-14187235IPR001005SANT/Myb domain
PfamPF002492.6E-14188230IPR001005SANT/Myb domain
CDDcd001671.05E-11190230No hitNo description
Gene3DG3DSA:1.10.10.601.7E-20190236IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MKAWPASVVY SSQENLTRYA SSSSYSSSPP SMGMVYADMD SLSLCSNYGV VSSHQDCYVS  60
NGGSNWGLPF MRECLGRNFE EHPNSDGADE GKGSDSSDDG GGEDSDKVNH NANNFNEENP  120
NENSNSGSGH SKLCARGHWR PAEDSKLKEL VALYGPQNWN LIAEKLEGRS GKSCRLRWFN  180
QLDPRINRRA FSEEEEERLM QAHRIYGNKW AMIARLFPGR TDNAVKNHWH VIMARKYREQ  240
SSAYRRRRLS QSVYRRVEEN TTSSNVSRDT ATAGTEPPPP YCLNLPNGGL ANNNNMPSFP  300
YAAAPFHGVV APPGGGVEYG LNGSPHMTAS KEANSTTKLA PPHIALYPQQ TPLDFFSGSR  360
SNDMVGEYFG QNHNPPSGFY SHYPQYLMLM QHQNNHNFYS FSNSTAQILG SEASLSSVAE  420
HRDQAMSSDP SDAIPPPFID FLGVGAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-341362367107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243248YRRRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158647.10.0hypothetical protein PHAVU_002G170500g
TrEMBLV7CP200.0V7CP20_PHAVU; Uncharacterized protein
STRINGGLYMA07G35581.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-72myb domain protein 105